Protein Info for Rru_A2747 in Rhodospirillum rubrum S1H

Annotation: Short-chain dehydrogenase/reductase SDR (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF23441: SDR" amino acids 8 to 249 (242 residues), 43.2 bits, see alignment E=6.6e-15 PF00106: adh_short" amino acids 11 to 200 (190 residues), 171 bits, see alignment E=4.5e-54 PF08659: KR" amino acids 12 to 173 (162 residues), 46.1 bits, see alignment E=1.1e-15 PF13561: adh_short_C2" amino acids 19 to 249 (231 residues), 216.8 bits, see alignment E=6.7e-68

Best Hits

Swiss-Prot: 38% identical to Y2146_BRADU: Probable short-chain type dehydrogenase/reductase blr2146 (blr2146) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 100% identity to rru:Rru_A2747)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQQ1 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Rru_A2747 Short-chain dehydrogenase/reductase SDR (NCBI) (Rhodospirillum rubrum S1H)
MAASLFDLAGKTALVTGSSRGLGFEMALALARAGAWVAVHGRGGADLERAVAAIRAAGGA
AEAVAFDLGEPEAGAAALEELTESWGGIDILVNNAGARDRRPLDDLDLAAVRQLLEIDLL
APFALSRRAAQAMPAGGRIINITSIAGQVARAGDAAYTTAKGGLDALTRALAAELGPRGI
TVNAIAPGYFATSANAAMVADAENERHLERRTALGRWGQPAEIAGAVVFLASPAASYVTG
QVLAVDGGYLAHF