Protein Info for Rru_A2728 in Rhodospirillum rubrum S1H

Annotation: NnrU (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details PF07298: NnrU" amino acids 14 to 221 (208 residues), 125.5 bits, see alignment E=1e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2728)

Predicted SEED Role

"NnrU family protein, required for expression of nitric oxide and nitrite reductases (Nir and Nor)" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQS0 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Rru_A2728 NnrU (NCBI) (Rhodospirillum rubrum S1H)
MGGVLDGFWQQGVALAVFLGTHAIAALPGARGALRRRLGAGGYLVGYSVVSLALLVWLTV
ATLGSPFVALWPPQPFAAVLLVAVMPGALILLVAALTEANPFSLGFSGRTFDPQRPHTCG
RVAHPLFVAFGLWAGLHLLANGDVAAALYFGPLLLLALAGPAVASAKAKARYGAVQLDLW
RRAARAAPPTTRLPALRTWIGGLLLYGAILFLHGPLIGLDPRDMLP