Protein Info for Rru_A2703 in Rhodospirillum rubrum S1H

Annotation: RNA methyltransferase TrmH, group 3 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF08032: SpoU_sub_bind" amino acids 117 to 185 (69 residues), 24.9 bits, see alignment E=2.2e-09 TIGR00186: RNA methyltransferase, TrmH family, group 3" amino acids 118 to 342 (225 residues), 171.5 bits, see alignment E=1.1e-54 PF00588: SpoU_methylase" amino acids 199 to 339 (141 residues), 126.4 bits, see alignment E=9.7e-41

Best Hits

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 100% identity to rru:Rru_A2703)

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQU5 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Rru_A2703 RNA methyltransferase TrmH, group 3 (NCBI) (Rhodospirillum rubrum S1H)
MKYGNSLAVSMIKWCPMFFLCRQGACDGAPSPPFSPPRDPEPAMTRPPRRPSRAPSSTES
SAAPAGRPLPRPAAGAGSTARPPRPPAPRGEADGASRRPEPAARGKRPGGRGDGGLWLFG
RHAVEAALQNPERKALRLLALAGAAEGLPKGGPTVEPADREAIEAVVPPGAVHQGLALKV
APLSQPTVEEIARIPGPSVVAILDQVSDPHNIGAVLRSAAAFGIRAVVVQDRHSPEETGT
LAKSASGTLERVPLVRAINLSQALDTFKEHGFWCAGLDASAETTLAEAALPERCVVVLGS
EGAGLRRLVRDHCDLLVKLAMDSGVESLNVSNAAAVTFYELSGRGLRP