Protein Info for Rru_A2691 in Rhodospirillum rubrum S1H

Annotation: Translation elongation factor G (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 TIGR00484: translation elongation factor G" amino acids 1 to 690 (690 residues), 1124.9 bits, see alignment E=0 TIGR00231: small GTP-binding protein domain" amino acids 9 to 179 (171 residues), 114.1 bits, see alignment E=5.5e-37 PF00009: GTP_EFTU" amino acids 9 to 281 (273 residues), 220.9 bits, see alignment E=3.2e-69 PF22042: EF-G_D2" amino acids 308 to 391 (84 residues), 68.1 bits, see alignment E=1.7e-22 PF03144: GTP_EFTU_D2" amino acids 323 to 389 (67 residues), 62.7 bits, see alignment E=1e-20 PF14492: EFG_III" amino acids 403 to 476 (74 residues), 110 bits, see alignment E=1.4e-35 PF03764: EFG_IV" amino acids 478 to 596 (119 residues), 150.2 bits, see alignment E=6.9e-48 PF00679: EFG_C" amino acids 599 to 685 (87 residues), 106.7 bits, see alignment E=1.6e-34

Best Hits

Swiss-Prot: 100% identical to EFG_RHORT: Elongation factor G (fusA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to rru:Rru_A2691)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQV7 at UniProt or InterPro

Protein Sequence (692 amino acids)

>Rru_A2691 Translation elongation factor G (NCBI) (Rhodospirillum rubrum S1H)
MKRETPLDRYRNIGIMAHIDAGKTTTTERILCYTGKSHKIGEVHDGAATMDWMEQEQERG
ITITSAATTAFWRENRVNIIDTPGHVDFTIEVERSLRVLDGAIAVFDSVAGVEPQSETVW
RQADKYKVPRMCFVNKMDRIGADFYRCVDMIIDRLGAVPLVINLPIGSESDYAGVIDLIK
MKAVIWHSEDLGAHFDYVDIPAEYAEKAAEYREKLLETAVEMDDAAMEAYLEGVEPDEET
LKKCIRKGTIAMKFVPVLNGSSFKNKGVQPMLDAVVDFLPSPLDVPAIHGLIPETHEDVI
RGCSDDEPFSALAFKIMNDPFVGSLTFARVYSGTVESGSYVQNTVKDKRERIGRMLLMHA
NNREEIKWAGAGDIVAIVGLKDTTTGDTLSDTIKPVILERMEFPEPVIEVAVEPKTKADV
EKMGMALARLAAEDPSFRVASDSESGQTVIKGMGELHLEILVDRMKREFKVECSVGAPQV
AYRETISKVFTVDYVHKKQSGGSGQFAKVSITFSPLPPGSGYQFESKIVGGSVPKEYIPG
VEKGLKSAIDTGVIAGFPVTDMKASLIDGGYHDVDSSVLAFEIAARAAFREGLPKAGPKL
LEPIMKVEVVTPEDYMGDVIGDLNSRRGNILGMDQRGNARVIGAMVPLANMFGYVNTLRS
MSQGRAQYTMHFDHYSEVPNNVSEEIRAKMAG