Protein Info for Rru_A2689 in Rhodospirillum rubrum S1H

Annotation: Ribosomal protein S10 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 TIGR01049: ribosomal protein uS10" amino acids 4 to 101 (98 residues), 159.8 bits, see alignment E=8.3e-52 PF00338: Ribosomal_S10" amino acids 7 to 101 (95 residues), 133.8 bits, see alignment E=1.1e-43

Best Hits

Swiss-Prot: 100% identical to RS10_RHORT: 30S ribosomal protein S10 (rpsJ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02946, small subunit ribosomal protein S10 (inferred from 98% identity to mag:amb3131)

MetaCyc: 74% identical to 30S ribosomal subunit protein S10 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S10p (S20e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQV9 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Rru_A2689 Ribosomal protein S10 (NCBI) (Rhodospirillum rubrum S1H)
MESQNIRIRLKAFDHRVLDQSTREIVSTAKRTGAQVRGPIPLPTRIEKFTVNRSPHIDKK
SREQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL