Protein Info for Rru_A2669 in Rhodospirillum rubrum S1H

Annotation: Ribosomal protein L15 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR01071: ribosomal protein uL15" amino acids 2 to 148 (147 residues), 156.1 bits, see alignment E=2.7e-50 PF00828: Ribosomal_L27A" amino acids 75 to 148 (74 residues), 74.4 bits, see alignment E=3.9e-25

Best Hits

Swiss-Prot: 100% identical to RL15_RHORT: 50S ribosomal protein L15 (rplO) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02876, large subunit ribosomal protein L15 (inferred from 100% identity to rru:Rru_A2669)

Predicted SEED Role

"LSU ribosomal protein L15p (L27Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQX9 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Rru_A2669 Ribosomal protein L15 (NCBI) (Rhodospirillum rubrum S1H)
MKLNELRDNPGATKNRIRVGRGIGSGKGKTAGRGVKGQKSREGVSINGFEGGQMPIYRRL
PKRGFNNPTRKSFAVVNLDRIQKAIDAKKLDATAVITEKALIEAGLVRRSQDGVRLLGKG
ELSVKVAIEVAGASATAREGVEKAGGTLTVTGAAAEAAPAAV