Protein Info for Rru_A2665 in Rhodospirillum rubrum S1H

Annotation: Ribosomal protein S11 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03632: ribosomal protein uS11
  • amino acids 10 to 126 (117 residues), 192.5 bits, E=1.3e-61
• PF00411: Ribosomal_S11
  • amino acids 19 to 128 (110 residues), 171.2 bits, E=4.2e-55

Best Hits

Swiss-Prot: 100% identical to RS11_RHORT: 30S ribosomal protein S11 (rpsK) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02948, small subunit ribosomal protein S11 (inferred from 100% identity to rru:Rru_A2665)

MetaCyc: 64% identical to 30S ribosomal subunit protein S11 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S11p (S14e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

See Q2RQY3 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Rru_A2665 Ribosomal protein S11 (NCBI) (Rhodospirillum rubrum S1H)
MAKPAQKLRRRERKNITSGIAHVSASFNNTKITITDVQGNAIAWSSAGAQGFKGSRKSTP
YAAQVAAEDAGRKAQEHGMKTLEVMVKGPGSGRESALRALQSVGFQVTSIKDVTPIPHNG
CRPRKRRRV