Protein Info for Rru_A2662 in Rhodospirillum rubrum S1H

Annotation: Peptidase S1C, Do (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details TIGR02037: peptidase Do" amino acids 61 to 488 (428 residues), 473.3 bits, see alignment E=4e-146 PF13365: Trypsin_2" amino acids 118 to 253 (136 residues), 123.6 bits, see alignment E=3.4e-39 PF00089: Trypsin" amino acids 119 to 279 (161 residues), 68.8 bits, see alignment E=1.9e-22 PF13180: PDZ_2" amino acids 310 to 383 (74 residues), 63.7 bits, see alignment E=4.8e-21 PF00595: PDZ" amino acids 315 to 370 (56 residues), 32.4 bits, see alignment 3.1e-11 amino acids 405 to 467 (63 residues), 26.2 bits, see alignment E=2.6e-09 PF17820: PDZ_6" amino acids 319 to 372 (54 residues), 42.3 bits, see alignment 1.6e-14 amino acids 435 to 468 (34 residues), 29.2 bits, see alignment (E = 2e-10)

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 100% identity to rru:Rru_A2662)

Predicted SEED Role

"FIG00803947: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQY6 at UniProt or InterPro

Protein Sequence (491 amino acids)

>Rru_A2662 Peptidase S1C, Do (NCBI) (Rhodospirillum rubrum S1H)
MIKAGEDRMDQSGRWARGVLAGASVAVLLAFGGPAAGAAEQVPGAGTAEQVPMAAAEIKL
TFAPVVRAVAPAVVNIFSQRVITESQVPPMFADPLFRRFLEERGMLGKPRERVQRSLGSG
VILRSEGVVVTNAHVVNGASEITVALNDRREFPAELVGLDPRADLAVLRIKSDTPLPSLA
LADGEPPEVGDLVLAIGNPFGVGQTVTSGIVSAQARTTAGISDYRFFIQTDAAINPGNSG
GALVDLSGRLVGINTAIYSRDGGSVGIGFAIPVEMVRSVVEGILEDGKVRHPWLGADGQS
VTTELASHMGLDRPLGVAITDVAKGGPAAKAGLAEGDVILALDGRPVFEGETLRYRIATH
RPGDKVVLGIRRDGKDTTLAVTLEAPPEDPPRDTTLLKGSHPFDGAEVSNMNPALAEELG
LEKASRGVTVTGLGDGVAARIGIRPGDRVIEVNGKAIDAVRDLKAAISKPSRVWQVVVDR
DGRAVRLVLGG