Protein Info for Rru_A2660 in Rhodospirillum rubrum S1H

Annotation: AAA ATPase, central region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 PF05496: RuvB_N" amino acids 18 to 141 (124 residues), 46 bits, see alignment E=1.8e-15 PF00004: AAA" amino acids 51 to 159 (109 residues), 58.8 bits, see alignment E=2.9e-19 PF07728: AAA_5" amino acids 51 to 138 (88 residues), 22.9 bits, see alignment E=2.5e-08 PF16193: AAA_assoc_2" amino acids 182 to 255 (74 residues), 62.2 bits, see alignment E=1.6e-20 PF12002: MgsA_C" amino acids 256 to 421 (166 residues), 224.2 bits, see alignment E=3.4e-70

Best Hits

KEGG orthology group: K07478, putative ATPase (inferred from 100% identity to rru:Rru_A2660)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQY8 at UniProt or InterPro

Protein Sequence (439 amino acids)

>Rru_A2660 AAA ATPase, central region (NCBI) (Rhodospirillum rubrum S1H)
MTKGLFDEAAPRPLADRLRPRQLAEVVGQDHLVGPDGPLGRMTAAHRLASVVLWGPPGCG
KTTIARLLADSTDLHFEPLSAVFAGVADLRKIFTAARERRTVGRGTLLFIDEIHRFNRAQ
QDGFLPYVEDGTVVLVGATTENPSFELNAALLSRCQVLVLRRLDDAALETLIARAEAECG
RSLPLSAEGRETLRALADGDGRYLLNLAEELIALPAEPLLDAAGLARVVQRRAPQYDKDR
EGHYNLISALHKALRGSDTDAALYWMGRMLAGGEDPLYLLRRLTRFAVEDIGLADPDALR
HAVAAWDTYERLGSPEGELALANLVIYLGTAPKSNAAYKAYGAAMRAAKQTGSLMPPLHI
LNAPTKMMKELGYSQGYAYDHDAPDGFSGQNYFPDGMARQRFYNPPERGFEREVRKRLAW
WDKLRRERRAAEPGDDDQS