Protein Info for Rru_A2658 in Rhodospirillum rubrum S1H

Annotation: haloacid dehalogenase-like hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00702: Hydrolase" amino acids 11 to 188 (178 residues), 95.6 bits, see alignment E=1.3e-30 PF12710: HAD" amino acids 13 to 184 (172 residues), 42.2 bits, see alignment E=3.2e-14 PF13419: HAD_2" amino acids 14 to 194 (181 residues), 118.2 bits, see alignment E=1.2e-37 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 88 to 194 (107 residues), 34.8 bits, see alignment E=1.7e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 93 to 188 (96 residues), 38 bits, see alignment E=2.1e-13 PF13242: Hydrolase_like" amino acids 150 to 215 (66 residues), 53.1 bits, see alignment E=6.2e-18

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to rru:Rru_A2658)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQZ0 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Rru_A2658 haloacid dehalogenase-like hydrolase (NCBI) (Rhodospirillum rubrum S1H)
MTAILSAPPLRLAIFDVDGTLADSQHNIVGAMTDAFRAHGLADPDPAAVRAIIGLSLVEA
VARVLPEAPPDQVAVVAQSYKQAFVTRRMGPAYTEQLFPGAAEAVRDLAARGVVLALATG
KSRRGVDVFLERHGLEGLFDAVRTADDGPGKPDPWMLNDILATLGCDAGSTAMVGDTTYD
VEMAVRAGIHAVGVAWGYHAQADLRAAGATLIVQEFGQVAAALDTCWEGATLPAAS