Protein Info for Rru_A2655 in Rhodospirillum rubrum S1H

Annotation: Intracellular septation protein A (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 14 to 47 (34 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details PF04279: IspA" amino acids 6 to 176 (171 residues), 196.7 bits, see alignment E=1.9e-62 TIGR00997: intracellular septation protein A" amino acids 6 to 177 (172 residues), 179.7 bits, see alignment E=3e-57

Best Hits

Swiss-Prot: 52% identical to YCIB_OLICO: Probable intracellular septation protein A (OCAR_4259) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: K06190, intracellular septation protein (inferred from 100% identity to rru:Rru_A2655)

Predicted SEED Role

"Intracellular septation protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RQZ3 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Rru_A2655 Intracellular septation protein A (NCBI) (Rhodospirillum rubrum S1H)
MNQFSKLALEAGPLIIFFVANATTNLITATAIFVAATLASLALSWALLRKVPVMPLVGGV
FVVVFGGLTVFLGDDLFIKIKPTIVNLLFAAILFVGLATGRLFIKLVLESALAMSEAGWR
ALTWRWAIFFVVLAIINEAVWRNFSSDTWVAFKVWGMMPLTIVFSAAQIPLLLRHQLPAP
PAGPEGDGRA