Protein Info for Rru_A2645 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 192 to 217 (26 residues), see Phobius details amino acids 229 to 246 (18 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 392 to 417 (26 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2645)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR03 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Rru_A2645 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MSIGLALGEANRRLVAPLIPACILTVVCLSLGAAWGLLALTPTALLTWGGPGPGVAALHL
LGIGVLLATVALVVPQILPVITLQDAPPAPVLTTILGLLVAGLGLLAAGFAGYDSQIAQW
GTRLLATAVAGFLGLWLRLLWRGRRSGLADVLLANVLALGFLGLAGGMGALLGADYGEGL
LADHQAFAHAHGIIAAFGFMGQVGLGFSGVLVPMLAIADPPARAATRPALLLGALAVLLA
AGGLVFSVPALVWAGLAAGGVTCLAHLRLMAQIMGRRLRPRLDPAFWLIRLSWGLLPAAL
VAGAGALAGIVSPLVMGVLLLPGWLLTLLLGVLQRIVPFLTSMHTVNSCARPIAITRLSW
PAALPVLALLHVLALALLLIGVGVEAALPIRLAGLAGLADSAVLGAFFATIAVRALAHRR
AVGPKRPPSPPHQG