Protein Info for Rru_A2634 in Rhodospirillum rubrum S1H

Annotation: Cobalt transport protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 83 to 120 (38 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 243 to 259 (17 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details PF02361: CbiQ" amino acids 73 to 276 (204 residues), 118.9 bits, see alignment E=1.3e-38 TIGR02454: cobalt ECF transporter T component CbiQ" amino acids 77 to 272 (196 residues), 142.7 bits, see alignment E=6.5e-46

Best Hits

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 100% identity to rru:Rru_A2634)

Predicted SEED Role

"Transmembrane component NikQ of energizing module of nickel ECF transporter" in subsystem ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR14 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Rru_A2634 Cobalt transport protein (NCBI) (Rhodospirillum rubrum S1H)
MGHASRPKVTRAVIPRTGAAPGLGLSCVVGGRRSAVPAVAPFVPSVSKKPSMETLLGSES
PPKSSFLSAVRGVVRGLDPRGRLLGALFCALVIVGLESPVALSLALILALCLLIGAGLPI
GRTLKRMAMMDGFIVAMLVLIPFTIPGDAAFSLFGWPASWQGLDRALVIGLRANGVILCL
MALVGSMEPTTLGHGLARLGLPDTLVHLLLLSVRYIDVINAEYGRLRRAMKTRGFRLANS
RHTYRTLGYLIGMLLVRALDRSERIARAMTCRGFTGRLPLLDTLAWSWRDGLFALLLIAA
LGGIVVVEIGHGRLA