Protein Info for Rru_A2625 in Rhodospirillum rubrum S1H

Annotation: Ribonuclease BN (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 112 to 137 (26 residues), see Phobius details amino acids 157 to 183 (27 residues), see Phobius details amino acids 203 to 220 (18 residues), see Phobius details amino acids 227 to 252 (26 residues), see Phobius details amino acids 265 to 290 (26 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 36 to 291 (256 residues), 190.4 bits, see alignment E=2.7e-60 PF03631: Virul_fac_BrkB" amino acids 47 to 295 (249 residues), 182.3 bits, see alignment E=6.9e-58

Best Hits

Swiss-Prot: 100% identical to Y2625_RHORT: UPF0761 membrane protein Rru_A2625 (Rru_A2625) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to rru:Rru_A2625)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR23 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Rru_A2625 Ribonuclease BN (NCBI) (Rhodospirillum rubrum S1H)
MVDDENRRRGLLGRRSHARSWLPVKPRRILATAGSFTILVLRALITHDIPRLAASLAYTS
LLALVPLIAIALAILAAFPGFGDERERMVAWIIETFVPYRRTEILDQVEHFVGAAAGLTA
LGVAGLTLTAIILLLTIESSLNAIFRVEKSRHPLARLLVYWSVLTGGPLLMGLSFSLSSY
LVAIRHLVGTDVMSPFDALTPTLGPPLLSLTAMTLLYMLVPNRPVPLFHALAGALVATLA
SALLRSAFLMVITRGLSYETLYGALAALPAFLVWMYLSWAVVLMGAVTAAEIPNWKMARR
LTRAGQDERAARLRIAVEIMVAAARAYGEGQGDGASRRALSALTATPDRRQAGVLRDLDK
AGLLIRDEDGAVLPGRDPRRITLAEILHALTLAPPTGTVGGPGWPDLLRHALETAGGDYD
RALGLSLDALVQAEPLGARI