Protein Info for Rru_A2605 in Rhodospirillum rubrum S1H

Annotation: Phosphoheptose isomerase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF13580: SIS_2" amino acids 23 to 143 (121 residues), 108.6 bits, see alignment E=2.7e-35 TIGR00441: phosphoheptose isomerase" amino acids 32 to 183 (152 residues), 211.7 bits, see alignment E=2.7e-67 PF01380: SIS" amino acids 96 to 164 (69 residues), 37 bits, see alignment E=2.7e-13

Best Hits

Swiss-Prot: 100% identical to GMHA_RHORT: Phosphoheptose isomerase (gmhA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 100% identity to rru:Rru_A2605)

MetaCyc: 56% identical to D-sedoheptulose 7-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase 1 (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR43 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Rru_A2605 Phosphoheptose isomerase (NCBI) (Rhodospirillum rubrum S1H)
MEDEIRAFCQTAADCFIRLGDCAPAIAEAAGVVTASLRAGGKVMFCGNGGSAADAQHLAA
ELEGRYLKERAPLPGMALTTNTSTLTAVGNDYGFDHIFSRQVSAHGRPGDVLVALSTSGN
SANVLKAIEAAREKGVSVIGLTGAGGGKMAEVCDLCIRVPSTQTPQIQQMHIAVGHLLCG
LVEDALCS