Protein Info for Rru_A2602 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 821 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 275 to 300 (26 residues), see Phobius details PF05228: CHASE4" amino acids 52 to 192 (141 residues), 96.9 bits, see alignment E=2.3e-31 PF00672: HAMP" amino acids 300 to 348 (49 residues), 45.1 bits, see alignment 2e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 348 to 521 (174 residues), 56 bits, see alignment E=2e-19 PF00990: GGDEF" amino acids 351 to 519 (169 residues), 78.2 bits, see alignment E=1.2e-25 PF00563: EAL" amino acids 540 to 790 (251 residues), 171.4 bits, see alignment E=4.3e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2602)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR46 at UniProt or InterPro

Protein Sequence (821 amino acids)

>Rru_A2602 Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) (NCBI) (Rhodospirillum rubrum S1H)
MSIRLKTALLSGILLAILVSGLGGVLWTVVRPGFQDIERARAADHMTALLAAISADIDSI
GTFILSYSSWDETYAFVRTGDPTYVANNLAVEGAKNAQSHFALVLTPKGRTVFSRLWNDD
FTATLPPPDAAGGGLPANHPLMAALSHPEGVRGLLQTPRGPLAVAARPILPSNEHGPPRG
VLVFGRWLTHALSDHPPLPHLSPLRLWLAPAPGDAPENVRRLLAADGPDLEIDGIGEPTS
LVTAGIRLVDLEGAPVAALTTTLAKTVEPQGESIIRLALVIAALGSLGVVAVGLVSNHLM
IVAPLRRLESHITTLSRTGDLDTRLVLDRKDEIGLLARAFATMQGRIRHLAHYDPLTGLP
NRTLFTMLGEGALARRRADRNGGGRRVGVAILDLDRLNTLTIGLGQGGSERALVAVGRRL
AALAGPADVVARGGDGRFLVLLGDLAPAQAGSIVEREAAERLASAFAKPFTPDDLVGAPL
SLTASIGLALFPQDGETLETLVTHAEVAVHQAKLLGRNNFQFFDDTLNRQAREILALESA
LYEALADNTLSLCFQPRIDAVRGHAIELKALARWDHPSRDLIVLEDVLPLIKQDGLLAEI
DRWMSNAACRQIRQWRDQGVSFPPIAIALSARPLTAGDPGLAPIAEAIAANGVDPGDLAV
EIAQSAIKGQFPETKAPETQAPEDRPAEELPWPDGLAGLGLGLVIDVADAGVVSPALLRR
FPLTRLTIGAALVAKLPDCRESRALVRALIALADELDLECLAEGVERGDQADWLLAAGCR
LQQGLFHARPQDQTVILRWLGQTPPRGLSSPGPRDRKQDGV