Protein Info for Rru_A2599 in Rhodospirillum rubrum S1H

Annotation: Tat-translocated enzyme (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details TIGR01412: Tat-translocated enzyme" amino acids 18 to 439 (422 residues), 457.1 bits, see alignment E=5.6e-141 PF04261: Dyp_perox_N" amino acids 77 to 227 (151 residues), 112.8 bits, see alignment E=1.4e-36 TIGR01413: Dyp-type peroxidase family" amino acids 77 to 426 (350 residues), 291.2 bits, see alignment E=1.1e-90 PF20628: Dyp_perox_C" amino acids 243 to 426 (184 residues), 163.5 bits, see alignment E=3.8e-52

Best Hits

Swiss-Prot: 57% identical to EFEB_ECOL5: Deferrochelatase/peroxidase EfeB (efeB) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 100% identity to rru:Rru_A2599)

MetaCyc: 56% identical to heme-containing peroxidase/deferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrous iron transport peroxidase EfeB"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR49 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Rru_A2599 Tat-translocated enzyme (NCBI) (Rhodospirillum rubrum S1H)
MSKPVDPGLFPAPALPLGRRHLLTGFGLTALGGSLAGLAASARADDRQTQSAPHATDAPV
DGVASPNDTVAYLGVHQAGIVTPRPANGMVASFAVLADTPDALETLFKTLTARIAFLTVG
GAVPQLDPKLPPADSGLLGPVIRPDALTITLSVGASLFDERPWLAPHKPRHLSRMTRFPN
DALDADLCHGDLSIQICANTQDTTIHALRDLIKATSRQLVLRWKQEGTVPVIAPRPDDRP
ESARNFLGFRDGSANPDSSDAPTMDRVVWVGRQDGEPAWAVGGSYQAVRLIRNFVERWDR
TPFGEQERIFGRTKITGAPLDKPDGHETDGPDYAADRDGRKTPLDSHIRLANARDAAAQE
NLILRRPFNYSNGVTKSGQLDQGLLFIAYQANLDRGFIAVQNKLNNEPLEEYIKPIGGGY
FYTLPGIIEASDYVGSTLVAAARGVSP