Protein Info for Rru_A2593 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase (GGDEF domain) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 159 to 179 (21 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 22 to 146 (125 residues), 74.7 bits, see alignment E=7.1e-25 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 397 to 562 (166 residues), 166.6 bits, see alignment E=2e-53 PF00990: GGDEF" amino acids 401 to 558 (158 residues), 145 bits, see alignment E=1.8e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2593)

Predicted SEED Role

"Putative diguanylate cyclase (GGDEF domain)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR55 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Rru_A2593 Putative diguanylate cyclase (GGDEF domain) (NCBI) (Rhodospirillum rubrum S1H)
MVCLATPATAQGRGEDLVVSRAYIEDPGGVLSIDDVVSRAAVPFDAVLSKGFSASVYWVR
LRVRAPEAGARTVLLISPSFLNDVRLFRRDPKAAQGWEVRVTGNLHPFAERERKAVSLSF
VVGVSPPQEDFYFRIKTRSPMTFEVQALSVEDANEQDYWRDIIEVFFVTSMVLLLIWGVH
QYFIDKQKILILFCIYQIVYTLYGIALTGYFASLSTRFFPELIDLINAIIYISAVLTSVL
FCREIFRPYKPHPLLMKGFLVFILAFPFQMIAMVAGYSDLAIISAALLMKLAVFYYVIVA
FSLKKDLFPTRNMLRLFFLSMAVANGAFWAGARLVDDVRAMSLIGVQSLIVDGFVVGVFF
AWLVHGRSQYGRRETERQLHMIRQAYEVEQERKRQAEWEARTDFLTGLLNRRSFVDLAER
ELARSLRYQRPFTLLMIDVDHFKAVNDTRGHLVGDVVLQNVARRIKETLRLIDIFGRTGG
EEFAAVIVETGGPEALEIARRLCAVVARDEIVQPEGEPIGVTISIGLTRSNGRSISFSAL
MNEADQALYAAKRAGRNQVVISQQALGAP