Protein Info for Rru_A2573 in Rhodospirillum rubrum S1H

Annotation: FeS assembly protein SufB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 TIGR01980: FeS assembly protein SufB" amino acids 17 to 475 (459 residues), 633.9 bits, see alignment E=6.4e-195 PF19295: SufBD_N" amino acids 135 to 205 (71 residues), 42.3 bits, see alignment E=6.5e-15 PF01458: SUFBD_core" amino acids 213 to 455 (243 residues), 259.2 bits, see alignment E=3.3e-81

Best Hits

Swiss-Prot: 73% identical to Y074_SYNY3: UPF0051 protein slr0074 (slr0074) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K09014, Fe-S cluster assembly protein SufB (inferred from 100% identity to rru:Rru_A2573)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufB" in subsystem Staphylococcal phi-Mu50B-like prophages

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR75 at UniProt or InterPro

Protein Sequence (484 amino acids)

>Rru_A2573 FeS assembly protein SufB (NCBI) (Rhodospirillum rubrum S1H)
MVATQNTVDTVREATEAYKYGFVTDIAVDIAPKGLNEDIVRLISAKKGEPEWMLEWRLKA
FRHWLTLTEPDWAKVSYPPIDYQDVHYYAAPKLSEGPKSLDEVDPELLETYAKLGIPLKE
QELLAGVVAVDAVFDSVSVATTYKKKLGQMGVIFCSISEAIREHPELVRKYLGSVVPYSD
NYFATLNCAVFTDGSFVYVPKGLRCPMELSTYFRINERNTGQFERTLIVCDDGAYVSYLE
GCTAPQRDENQLHAAVVELVALDDAQIKYSTVQNWYPGDKNGKGGIFNFVTKRGACRGKN
SKISWTQVETGSAVTWKYPSCILQGDNSMGEFYSVAITNNAQQADTGTKMIHIGRNTRSR
IISKGIAAGRSDQTYRGLVRMLPKAEGARNFTQCDSLLIGDRCGAHTVPYIESRNPTAKV
EHEATTSRIGDDQLFYCLQRGIAEEDAVALIVNGFCKEVLQTLPMEFAVEAQKLVSISLE
GSVG