Protein Info for Rru_A2572 in Rhodospirillum rubrum S1H

Annotation: FeS assembly ATPase SufC (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR01978: FeS assembly ATPase SufC" amino acids 16 to 267 (252 residues), 342 bits, see alignment E=9.2e-107 PF00005: ABC_tran" amino acids 41 to 196 (156 residues), 77.4 bits, see alignment E=8.3e-26

Best Hits

Swiss-Prot: 66% identical to Y075_SYNY3: Probable ATP-dependent transporter slr0075 (slr0075) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K09013, Fe-S cluster assembly ATP-binding protein (inferred from 100% identity to rru:Rru_A2572)

Predicted SEED Role

"Iron-sulfur cluster assembly ATPase protein SufC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR76 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Rru_A2572 FeS assembly ATPase SufC (NCBI) (Rhodospirillum rubrum S1H)
MMTLSKTEKDRAMALLEIKDLHARVEDEASGRGEGAYREILKGLSLTINPGEVHAIMGPN
GAGKSTLSSVITGKPGYEMTAGSLIYQGRDLCALEPHERACEGIFLAFQYPVEIPGVGFT
TFLKTAINARRKYFGQEDIDAMDFLKLMKSKTKLLGIADDMMKRPVNVGFSGGEKKRAEI
LQMAMLEPTLMILDEMDSGLDIDALRIAAQGVNDMRSPDRAILCITHYQRLLDYIVPDFV
HVLADGKIVKSGGKDLALELEEKGYAEFVARAA