Protein Info for Rru_A2546 in Rhodospirillum rubrum S1H

Annotation: chemotaxis sensory transducer (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details PF22673: MCP-like_PDC_1" amino acids 93 to 215 (123 residues), 55.4 bits, see alignment E=1.6e-18 PF00672: HAMP" amino acids 338 to 387 (50 residues), 39.8 bits, see alignment 9.3e-14 PF00015: MCPsignal" amino acids 493 to 650 (158 residues), 112.7 bits, see alignment E=3.6e-36

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to rru:Rru_A2546)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RR99 at UniProt or InterPro

Protein Sequence (690 amino acids)

>Rru_A2546 chemotaxis sensory transducer (NCBI) (Rhodospirillum rubrum S1H)
MGILFGTIRKQILIPLVGVITIGMVAITFYASIVQFDAAREAGYQVMLEQSRAEANTVSH
LLDEALTTVRTNADWARSFALGDSFDRQGFAQALLQVLRSSPALTGVYAGFEPNFDGRDA
DHAKTALGDDTGRFLIYAYRANDTETLAITPLTGDPAEENWYYRPLRDKRESITPPYEFE
VDGHRFLMSTVVVPILKDGKALGVATADVGLDRIAQEVSRLKPMGVGYAVVVSADGQWVA
APRPELLGKPVDDPAFREALDKIKDAEVQKTVFTDSLTGEKSVMVMVPIRIGRAAETWGI
AMVVPEAALLAEASAARIRLILVGLGILLAAALTAVLVGNAIVRPVRDMTQAMTRLAEGA
LGVSVPGTDRRDEIGAMSKAVRIFKDNAAAMLEMSRKSESLEREAQESRRQAQARLADRF
EGEVAAMIHVLGEAASGLREQAQIMTDTAQTVATHAATVDAAAGQTSANVQTVASASEEL
ASSIGEISRQVGQSSSVAADAVRQVEQSQQTIVALERSALRIGEVVTLINTIASQTNLLA
LNATIEAARAGDAGKGFAVVAGEVKALANQTARATEEIVGQIGSVQAGTRDVVAAISMIS
TTIESMSQISTQIAGAVEEQAAATQEITRSVQQVAQGTQTVTEAISDVYSGTVKNGDHAR
VVHRTAEQVAEDAKGLAHKVNDFLADIRGG