Protein Info for Rru_A2509 in Rhodospirillum rubrum S1H
Annotation: Fructose-bisphosphate aldolase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01623, fructose-bisphosphate aldolase, class I [EC: 4.1.2.13] (inferred from 100% identity to rru:Rru_A2509)Predicted SEED Role
"Fructose-bisphosphate aldolase class I (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)
MetaCyc Pathways
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
- Calvin-Benson-Bassham cycle (12/13 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- homolactic fermentation (11/12 steps found)
- glycolysis III (from glucose) (10/11 steps found)
- glycolysis IV (9/10 steps found)
- pentose phosphate pathway (non-oxidative branch) II (6/6 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (8/9 steps found)
- gluconeogenesis III (10/12 steps found)
- superpathway of anaerobic sucrose degradation (15/19 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- ethene biosynthesis V (engineered) (19/25 steps found)
- oxygenic photosynthesis (13/17 steps found)
- gluconeogenesis I (10/13 steps found)
- glycolysis I (from glucose 6-phosphate) (10/13 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
- sedoheptulose bisphosphate bypass (2/2 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
- glycolysis VI (from fructose) (7/11 steps found)
- glycolysis V (Pyrococcus) (6/10 steps found)
- 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
- sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
- superpathway of hexitol degradation (bacteria) (11/18 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
- superpathway of N-acetylneuraminate degradation (13/22 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
- Glycolysis / Gluconeogenesis
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 4.1.2.13
Use Curated BLAST to search for 4.1.2.13
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RRD6 at UniProt or InterPro
Protein Sequence (310 amino acids)
>Rru_A2509 Fructose-bisphosphate aldolase (NCBI) (Rhodospirillum rubrum S1H) MPTITPTVKRILDAYESDNPGTKANLARILMHGALGGTGKMVILPVDQGFEHGPARSFAV NPPAYDPHYHFQLAVDAGLNAFAAPLGLIEAGADSFAGAIPTILKVNSANSLTVDKQAPT QALTAGVADALRLGCSAIGYTLYPGSDNAYDMIETLRELVIEAKEVGLAVVVWSYPRGGT LSKDGETALDICAYAAHIACLAGAHIVKVKLPTEALELPEAMAVYQSEGIVRETLAQRVA HIVQSCFAGRRLVVFSGGGHKGVSGLLDDARAIRDGGGNGSIIGRNTFQRPRDEALDLLR DLIDIYKKKP