Protein Info for Rru_A2497 in Rhodospirillum rubrum S1H

Annotation: Peptide chain release factor 3 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 TIGR00503: peptide chain release factor 3" amino acids 5 to 527 (523 residues), 696.3 bits, see alignment E=2.2e-213 PF00009: GTP_EFTU" amino acids 10 to 276 (267 residues), 179.1 bits, see alignment E=1.9e-56 TIGR00231: small GTP-binding protein domain" amino acids 14 to 151 (138 residues), 78.2 bits, see alignment E=6.2e-26 PF01926: MMR_HSR1" amino acids 14 to 141 (128 residues), 28.3 bits, see alignment E=4.1e-10 PF22042: EF-G_D2" amino acids 294 to 380 (87 residues), 85.1 bits, see alignment E=7.1e-28 PF03144: GTP_EFTU_D2" amino acids 313 to 378 (66 residues), 37 bits, see alignment E=9.7e-13 PF16658: RF3_C" amino acids 387 to 512 (126 residues), 139.8 bits, see alignment E=1.2e-44

Best Hits

Swiss-Prot: 58% identical to RF3_DICNV: Peptide chain release factor 3 (prfC) from Dichelobacter nodosus (strain VCS1703A)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 100% identity to rru:Rru_A2497)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRE8 at UniProt or InterPro

Protein Sequence (530 amino acids)

>Rru_A2497 Peptide chain release factor 3 (NCBI) (Rhodospirillum rubrum S1H)
MTAIEDEVQRRRTFAIISHPDAGKTTLTEKLLLFGGAIQLAGAVKARGEVRRARSDWMKV
EQERGISVASSVMSYEYAGRAFNLLDTPGHEDFSEDTYRTLTAVDSAVMVIDAAKGIEEQ
TRKLFEVCRLRDVPIITFINKLDREGQDPFDLLDEIEQTLALDVTPASWPIGMGRDFLGC
YDLFNDRLALMAKGAKGSLPTPGERCEGLDDPKLDKMLPADAVAKLRGDVEMVRGLCPAF
DAEAYRAGTMTPVFFGSAVNNFGVRELLEGVAHLAPSPRPQPTTTRDIQPTEDKVTGFVF
KIQANMDPKHRDRIAFVRLCSGPFRRGMKLFHVRTGKQMNMHNPVMFLARERELAEEAFA
GDIMGVPNHGQLRIGDTLSEGENLRVTGIPSFAPEMLQKVRPKDPLRAKHLGRALQQIAE
EGAARVFKPIMGADWIVGVVGPLQFEVLADRIRTEFDVPVLFESTALYTARWVTAEDPLV
LKKFLDGNQASLAEDHDGDPVFLARNAWHLDRAAEDFPLIVFHKTKEQAV