Protein Info for Rru_A2496 in Rhodospirillum rubrum S1H

Annotation: Polysaccharide biosynthesis protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 83 to 113 (31 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 380 to 414 (35 residues), see Phobius details PF01943: Polysacc_synt" amino acids 10 to 290 (281 residues), 40.8 bits, see alignment E=9.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2496)

Predicted SEED Role

"COG2244: Membrane protein involved in the export of O-antigen and teichoic acid"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRE9 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Rru_A2496 Polysaccharide biosynthesis protein (NCBI) (Rhodospirillum rubrum S1H)
MSGLVDRRFKRNVLVNYGATAISVAAGFAHVTLVTRFGGVDVYGSFGILVAFSAMLTNLM
TVRTNDAVVVFYKRGSATGDPGLCKMALLVGLCLDILIGGLLFGAFALCAPWIAQAVLKR
PDLASDVALYGWILLATFLRGTPIGYLTAREHFPLIYAMNAGEPVVRIALIGLVVLSGAA
VTLRDVITAVLLPTAAFSLIAYILVLVPLLGRLRPVPAAWGALRDYAKFSLSTFLSSTIR
AAGGIDTVVLGYVTNPATVGLVNILRQFLAPFPFLAAPINGQAYPRFVQAVSEHKRAEIT
ATIAQVNQKLRLVALPLIAVLAPGLVGYTLWVGVPLAATDYLAFGLMALTAVVTSTMWWC
RPLSHATNPNISLRADILSTLTLVVTVYPLALFFGVLGVALCQATVLASIYFYWRRVLRG
FVV