Protein Info for Rru_A2492 in Rhodospirillum rubrum S1H

Annotation: Glycosyl transferase, group 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 92 to 113 (22 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details PF13579: Glyco_trans_4_4" amino acids 15 to 170 (156 residues), 48.5 bits, see alignment E=3.3e-16 PF13439: Glyco_transf_4" amino acids 15 to 172 (158 residues), 73.5 bits, see alignment E=5.5e-24 PF20706: GT4-conflict" amino acids 154 to 293 (140 residues), 33.5 bits, see alignment E=5.9e-12 PF13692: Glyco_trans_1_4" amino acids 192 to 333 (142 residues), 118.7 bits, see alignment E=6.3e-38 PF00534: Glycos_transf_1" amino acids 193 to 346 (154 residues), 118.2 bits, see alignment E=7.4e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2492)

Predicted SEED Role

"Alpha-1,4-N-acetylgalactosamine transferase PglH (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRF3 at UniProt or InterPro

Protein Sequence (371 amino acids)

>Rru_A2492 Glycosyl transferase, group 1 (NCBI) (Rhodospirillum rubrum S1H)
MKIVMVIKGLHETAGGAERIFCDVANHLAGRGHRVGVLSFDSPGEEPFYDLSGVDDVVGL
AIGDVHRPTSPLIFQRRVSALRREILARRPDVVIAFMHSCFVPTALALIGTGIPVVASEH
TVITHYRKRLGQLALYALSVPLLRSITVVSQAVKERFPRVIRRKMVVMPNPVALPAAVPE
PALDAPPGRPARRILSIGRFDEAKGHGVLLEAFARIARDFPEWDLRIVGDGPTREALRQR
AIALGLSERVAMPGIVRNIAAEWQACAVFALASRYESFGLVIAEAMAAGRPAIGFIDCPG
VNTLIEDGRTGLLVGGEDRPAALAAGLWRLLSDPDLRQTMGAAAREAIAGQFHIERICDQ
WEALLSETLDP