Protein Info for Rru_A2473 in Rhodospirillum rubrum S1H

Annotation: PAS/PAC Sensor Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 TIGR00229: PAS domain S-box protein" amino acids 39 to 163 (125 residues), 26.3 bits, see alignment E=3.3e-10 PF13188: PAS_8" amino acids 41 to 77 (37 residues), 29.1 bits, see alignment 1.7e-10 amino acids 171 to 208 (38 residues), 18 bits, see alignment 5.2e-07 PF12860: PAS_7" amino acids 43 to 161 (119 residues), 87.3 bits, see alignment E=2e-28 amino acids 174 to 290 (117 residues), 78.8 bits, see alignment E=9.2e-26 PF08448: PAS_4" amino acids 44 to 157 (114 residues), 25.1 bits, see alignment E=4.4e-09 PF02518: HATPase_c" amino acids 431 to 542 (112 residues), 80.3 bits, see alignment E=3.8e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2473)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRH2 at UniProt or InterPro

Protein Sequence (550 amino acids)

>Rru_A2473 PAS/PAC Sensor Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MTNSRVKADQDGAVKPVAGGESLPQSDGSADRLTGLSLHSLVIEHMDQGVLVADAKTRVI
AWNRRACELLGVSADFLASGPTHVEVLGEMIRTGALVTAEIDPVSTLIAAWLDLPEGERR
PLIYERGNPTGLRIEVRTSPLPEGGYVRTFTDITQRKAAEQALAEKTRLLDTTLETIAQG
IILVDPSLHIVLCNRRYRELLDLPDYMLEPFPPRAADIIAFQIGRGDFDILPADVTHRPF
WDRIEGFVFSPGTTERPLRDGRTLGVETFALDGGGWVRTFTDITEGKRAQDALLVSEKMA
SLGQLVAGIAHEINTPIGTGVTAASLLAEKTQSLVQAVEAGALRRSQLDAYLHVARESSR
FILSNLTRAAELIQSFKQVAVDQATDESRLFKVRDYLEEILLSLQPRLKRTPHTMTLECP
DDLAMYGPPGALFRVITNLVINSLMHGLEEGATAPPGHMVLRVGHEKDTDCVVFRYHDTG
RGIPEKNLKRIFDPFFTTRRGEGGTGLGLHIVYNLVTQTLGGSLAVHSPPGQGAIFLIRV
PRLSAGLPEG