Protein Info for Rru_A2453 in Rhodospirillum rubrum S1H

Annotation: membrane anion transport protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 50 to 77 (28 residues), see Phobius details amino acids 85 to 111 (27 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 170 to 197 (28 residues), see Phobius details amino acids 231 to 261 (31 residues), see Phobius details amino acids 274 to 298 (25 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 394 to 412 (19 residues), see Phobius details PF03600: CitMHS" amino acids 26 to 345 (320 residues), 152.4 bits, see alignment E=8.5e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2453)

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRJ2 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Rru_A2453 membrane anion transport protein (NCBI) (Rhodospirillum rubrum S1H)
MDLFILAVFIATYLGMALGRVPGLGVDRTGIALLAAIVLQTVAPRDGAALVAAIDFETLA
ILFGLMVVSIQFAACGFHDRCAHWLANAACGPFVLLALVVGVAGGLAALLTNDVVALAMT
PMLTRGLMARGLDPKPYLIALAGAANAGSAATLIGNPQNILIAQTGDLDLLPFLGACLPP
ALIGMACCWACVAVIWRAALRRPAVPPAAPPAAPPATMAPPAVDRSGLIKGLVATALLLV
LFLTPLDRATAALIVAGLILTSRRLRSRDTLGLVDWQLLILFVGLFVVVDSFTATGLPSL
LLDAATTRGLDPLATGPMVALTLAGSNTIGNVPLITLWLSILPAAPTEALYRLAVFSTLA
GNFLLIGSIANLIVADQAARQGVSLGFLDHARCGVPMTLLSLGFAWGWFALIA