Protein Info for Rru_A2435 in Rhodospirillum rubrum S1H

Annotation: Acetyl-CoA carboxylase, biotin carboxylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF00289: Biotin_carb_N" amino acids 1 to 110 (110 residues), 156.7 bits, see alignment E=7e-50 TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit" amino acids 1 to 441 (441 residues), 693.7 bits, see alignment E=5.5e-213 PF02786: CPSase_L_D2" amino acids 115 to 320 (206 residues), 251.1 bits, see alignment E=2e-78 PF02222: ATP-grasp" amino acids 137 to 291 (155 residues), 34.5 bits, see alignment E=4e-12 PF07478: Dala_Dala_lig_C" amino acids 142 to 290 (149 residues), 33.8 bits, see alignment E=6.4e-12 PF02785: Biotin_carb_C" amino acids 335 to 440 (106 residues), 136.9 bits, see alignment E=6.9e-44

Best Hits

Swiss-Prot: 60% identical to ACCC_HAEIN: Biotin carboxylase (accC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01961, acetyl-CoA carboxylase, biotin carboxylase subunit [EC: 6.3.4.14 6.4.1.2] (inferred from 100% identity to rru:Rru_A2435)

MetaCyc: 59% identical to biotin carboxylase (Escherichia coli K-12 substr. MG1655)
Biotin carboxylase. [EC: 6.3.4.14]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 6.3.4.14 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRL0 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Rru_A2435 Acetyl-CoA carboxylase, biotin carboxylase (NCBI) (Rhodospirillum rubrum S1H)
MFDKILIANRGEIALRIHRACREMGIKTVAVHSTADSEAMHVRLADESVCIGPPSARDSY
LSKAAIISAATITNADAIHPGYGFLSENADFAEMVQDHGFTFIGPSPRHIRLMGDKITAK
QAALEAGLPCVPGSAGAVTSEEEGLKVAAAFGYPVLFKATAGGGGRGMKVATGPHDLGEA
FRTARTEAQAAFGNSEVYMEKYLQNPRHIEVQVLGDNYGGAVYLGERDCSLQRKHQKVLE
EARSPALNDEARARIGEIARRAVERLGYSNAGTMEFLYEEGEFYFIEMNTRLQVEHPVTE
MITGIDVVREQIRIAAGAPLGYDQSAIRFHGHAIECRVNAEDPVTFAPSPGRVTYFHQPG
GMGVRVDSGLYQGVMVPPHYDSMVAKLIVHGATRNECLMRLRRALDEFVIEGIQTTLPLH
RRIVRAPEFVDGAYDIRWLENFVDQ