Protein Info for Rru_A2427 in Rhodospirillum rubrum S1H

Annotation: LrgB-like protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 193 to 209 (17 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details PF04172: LrgB" amino acids 26 to 238 (213 residues), 248.5 bits, see alignment E=2.4e-78

Best Hits

Swiss-Prot: 31% identical to YXAC_BACSU: Uncharacterized protein YxaC (yxaC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2427)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRL8 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Rru_A2427 LrgB-like protein (NCBI) (Rhodospirillum rubrum S1H)
MNGLPGEIHDLWVYLHATPLFWLTVTLLAYLIGLGLHSVARLNPLVNPVAIAVLLLVGLL
KITGTDYHDYFSGAQFVHFLLGPATVALAVPLFENIGKVRQALIPMGIALVVGSTVAAGS
AMGLAALTGATPEVLLSMAPKSATTPIAMGISESIGGLPELTAVMVILTGVLGAVIVTPL
MTLLGIKDMRARGFAAGVAAHGLGTARAFQVDPLAGTFAGIGMGMNGLMTTLVVAVLVGF
F