Protein Info for Rru_A2408 in Rhodospirillum rubrum S1H

Annotation: RecJ exonuclease (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 217 to 235 (19 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 53 to 602 (550 residues), 535.5 bits, see alignment E=5.8e-165 PF01368: DHH" amino acids 107 to 265 (159 residues), 86.9 bits, see alignment E=2.1e-28 PF02272: DHHA1" amino acids 384 to 478 (95 residues), 60.6 bits, see alignment E=2.6e-20 PF17768: RecJ_OB" amino acids 492 to 601 (110 residues), 71.3 bits, see alignment E=1e-23

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 100% identity to rru:Rru_A2408)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRN7 at UniProt or InterPro

Protein Sequence (606 amino acids)

>Rru_A2408 RecJ exonuclease (NCBI) (Rhodospirillum rubrum S1H)
MTDILTPAAPPALPTRDAAFLGVERSRGGRRWVLRPGDERQALAISQRLGVPEVVGRVLT
GRGVQVEEADGFLTPTLRALLPDPGHLLDMDKAVARLSKAVRDKETIAIFGDYDVDGATS
TALMHRFFRSLGARVLIHIPDRVLEGYGPNAPALEALAAKGARVVLTVDCGISAFDALRA
AKAAGLDVVVCDHHEARTELPAAVAVVNPKRLDEASPHTHLAAVGVAFLMAVAINRDLRD
SGWFAAEQRPPPDLMALLDLVALGTVCDMVPLIGVNRALVQQGLKVIAKRTNPGIAALAE
VSGVRDRVDAFHLGFMLGPRVNAGGRVGQAGMGAALLSSEDPLECLDFARQLDAFNGARK
EIEAAVLHQAIEQVEAAPANDLPLVFASGTDWHPGVVGIVASRLKERYGLPACAVALDGG
LAKGSGRSVGGVDLGRVVIAAREAGVLEAGGGHAMAAGFSLRTDRLEEFRQFLGERLKDQ
VAALALVASLDLDGVLDVRGANAQLVRALSQAGPYGSGNPEPRFAVANARVGKVDVVGMG
HVRCFLNGPSGGSLKAMAFKAADSEIGHALLTAHGASLHVAGTLRLDSFQGRETVVLVVD
DVAPCS