Protein Info for Rru_A2400 in Rhodospirillum rubrum S1H

Annotation: Ribulose-bisphosphate carboxylase, form II (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF02788: RuBisCO_large_N" amino acids 13 to 132 (120 residues), 124.2 bits, see alignment E=3.5e-40 PF00016: RuBisCO_large" amino acids 142 to 440 (299 residues), 434.9 bits, see alignment E=1.6e-134

Best Hits

Swiss-Prot: 100% identical to RBL2_RHORT: Ribulose bisphosphate carboxylase (cbbM) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01601, ribulose-bisphosphate carboxylase large chain [EC: 4.1.1.39] (inferred from 100% identity to rru:Rru_A2400)

MetaCyc: 100% identical to ribulose bisphosphate carboxylase subunit (Rhodospirillum rubrum)
Ribulose-bisphosphate carboxylase. [EC: 4.1.1.39]

Predicted SEED Role

"Ribulose bisphosphate carboxylase (EC 4.1.1.39)" in subsystem AMP to 3-phosphoglycerate or CO2 uptake, carboxysome or Calvin-Benson cycle or Photorespiration (oxidative C2 cycle) (EC 4.1.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.39

Use Curated BLAST to search for 4.1.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRP5 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Rru_A2400 Ribulose-bisphosphate carboxylase, form II (NCBI) (Rhodospirillum rubrum S1H)
MDQSSRYVNLALKEEDLIAGGEHVLCAYIMKPKAGYGYVATAAHFAAESSTGTNVEVCTT
DDFTRGVDALVYEVDEARELTKIAYPVALFDRNITDGKAMIASFLTLTMGNNQGMGDVEY
AKMHDFYVPEAYRALFDGPSVNISALWKVLGRPEVDGGLVVGTIIKPKLGLRPKPFAEAC
HAFWLGGDFIKNDEPQGNQPFAPLRDTIALVADAMRRAQDETGEAKLFSANITADDPFEI
IARGEYVLETFGENASHVALLVDGYVAGAAAITTARRRFPDNFLHYHRAGHGAVTSPQSK
RGYTAFVHCKMARLQGASGIHTGTMGFGKMEGESSDRAIAYMLTQDEAQGPFYRQSWGGM
KACTPIISGGMNALRMPGFFENLGNANVILTAGGGAFGHIDGPVAGARSLRQAWQAWRDG
VPVLDYAREHKELARAFESFPGDADQIYPGWRKALGVEDTRSALPA