Protein Info for Rru_A2399 in Rhodospirillum rubrum S1H

Annotation: conserved hypothetical protein VC1941 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details PF10129: OpgC_C" amino acids 2 to 352 (351 residues), 170.8 bits, see alignment E=2.1e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2399)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRP6 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Rru_A2399 conserved hypothetical protein VC1941 (NCBI) (Rhodospirillum rubrum S1H)
MLNHSSLGYVQDAQGFVFISGLIVGLYYAKGYLKGRSLEMDTKIYARAGLLYRYSLVLLG
LLFVLPLVFPTFAAPWERFYADFFRDPLTIGMGALILLYQPTYMDILPQYILYLLLTPFL
IRLALNGKGVQVLGGSIAVWLLTQIGAHTLLITAIEEAGQSVAPDFITRAGFNPMGWQLL
FVSGLVIGAGLTKGTLKIGDWFDASRPGPALTSLALVVYFMVMRLGFTFDYLPDHVVQAF
RMLDHRTTFSLIYPINFLALGYLVTWLIICGPHAASPIVQKAGWVLKGLFMMEFLRFLGR
HSLQVYAFHLVLVFAMYFVDFYTEEFNEVAKTGIVLSGVALLAVPAWLHEQKQKAKTAQR
AAART