Protein Info for Rru_A2395 in Rhodospirillum rubrum S1H

Annotation: TonB-dependent siderophore receptor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 812 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details PF07660: STN" amino acids 70 to 120 (51 residues), 33.1 bits, see alignment 6e-12 PF07715: Plug" amino acids 167 to 266 (100 residues), 71 bits, see alignment E=1.7e-23 TIGR01783: TonB-dependent siderophore receptor" amino acids 168 to 810 (643 residues), 364.2 bits, see alignment E=7.9e-113 PF00593: TonB_dep_Rec_b-barrel" amino acids 343 to 782 (440 residues), 200.3 bits, see alignment E=1.7e-62

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to rru:Rru_A2395)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRQ0 at UniProt or InterPro

Protein Sequence (812 amino acids)

>Rru_A2395 TonB-dependent siderophore receptor (NCBI) (Rhodospirillum rubrum S1H)
MRHEGRVGRTGRRAALVAGASVAVLVMGGVGAAGAASAPQVSQAAAVRSFDIPAQSLAGA
LTLFGDQAGVQIAAESAVVAGRAAPAVSGAMAPEEALRRLLAGSGLLWRFTDATTVVLEK
PAAAGGVTVADPVTVEAAPLRQSPTGPVAGFVAERSITATKTDTPIVETPQAIAVVTADQ
MDKRAVQNVGQALGYAAGVVAQPSGADARYDVPQIRGFSVAEGQYLNGLRIMRGFGAPSV
EVYGLERIEALRGPSSVLYGQASPGGLLNMISKRPVDEAFGEITVEAGSEKRFQGGFDLG
GPIADDLPLTYRLTGVVRDSGTQMDHIDDDRYFLAPAVTWKSDDQATRVTLLTQVQHDRS
GSPLGLPLAGTLYDNPLGKLSRDLYLGEPDFDESARTQWSLGYEAERRVNDQVTLRQNAR
YMALDWDYQGLYYAGLASDNRTAYRGTSYQNEDLDTVNVDTQGEVTLGTGPLAHTVLGGV
DVRYFDAHTKSLFGSAPSIDIYNPVYGQAIAAPTGSATDKTQRMTQVGLYVQDQIRWHDW
QLTAGLRHDVATIRTKIKGKGGGKQDDAATTGRVGLSYIFDFGLVPYLSYSTSFDPQTGT
AAPQRGGGNFDSSQGRQYEAGMKFQPKGYNSFLAASLFDLTQTNVKSSDPLYSGYSVQTG
EITVQGFELEALASLYEGLNLSASYTLQEAEITGGAASEKGNRPANVPSQTASLWVDYTI
QPQSAVGKLGLAGIGLGGGVRYVGERYGDNANTIKLESNTVFDAEIGYERETWKVALNLN
NLTDEDTIGTCTAFGCYYGDGRTVVGKLTYRW