Protein Info for Rru_A2388 in Rhodospirillum rubrum S1H

Annotation: ABC-3 transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details PF00950: ABC-3" amino acids 25 to 286 (262 residues), 166.5 bits, see alignment E=8.4e-53 PF01032: FecCD" amino acids 62 to 260 (199 residues), 27.4 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: K09816, zinc transport system permease protein (inferred from 100% identity to rru:Rru_A2388)

Predicted SEED Role

"ABC transporter in pyoverdin gene cluster, permease component" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRQ7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Rru_A2388 ABC-3 transporter component (NCBI) (Rhodospirillum rubrum S1H)
MSFEALRAVVQGWAAAGLLPAGLTYGFLVNALIAALIAGPVLGGLGTLVVTKRLAFFSEA
VGHAALTGVAIGILLGEPYTGPYASLFGYCLLFALLVAFLRNRTGLATETLIGVFLSVSL
ALGASLLLMLSTRVNVHILENVLFGSVLTVDDRDLGVLLVVGLGVSVVGLPLFNRLMLGG
FNPALAQVRGVRVVFLDYLFLMLVTVVTVASVKIIGAILVGALLVIPAAAARVAARSLRG
FFLLSIVFATLSAVAGILIPVHFDLPIPSGGAIILAAGLLFLGASVARMLSRSKPS