Protein Info for Rru_A2336 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 9 to 33 (25 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 309 to 333 (25 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details PF13000: Acatn" amino acids 11 to 154 (144 residues), 28.6 bits, see alignment E=5.7e-11 PF07690: MFS_1" amino acids 15 to 343 (329 residues), 80.2 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2336)

Predicted SEED Role

"Major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRV9 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Rru_A2336 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MTHMPRSTWLLLGSLYTTQFLGLGFLVVALVAIMRDQGATLDQVGMVYMLGMVWPFKVLW
APMIDKIRFGRYGHYRVWLLLMQGGLALVLLAMGFLDVIGDFPIIYLLGALIAFLSASQD
IAVDGLACRLLSPDQRGMGNGIQIAGGLLGNMLGGGVVLLTYPWLGWQGSLLLLAAGTSV
SFLQVLWYDEPARAIVRAEGATLFRCVAGFWTRAGGRYWLMLLMLNPIGCGLAYAVTIPV
LVDRGWGMDRIGLMVNVFGSIAGIVAAFVTGSLLHRFSRRAVLVGAAFFQVPGIAVILVP
AVWGFGDGVATLAVILYFLCYNPAATVLATLMMDHASPRRPATDYTFQYSLNMGFAMGAM
SLAAALAQRIGYGGVVILGAAVAVLVALLSMGYRSPSSDREGEGAAGSLGVAAAPMALAR
EKGA