Protein Info for Rru_A2309 in Rhodospirillum rubrum S1H

Annotation: NADH peroxidase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 5 to 286 (282 residues), 199.7 bits, see alignment E=1.8e-62 PF00070: Pyr_redox" amino acids 153 to 219 (67 residues), 52.7 bits, see alignment E=1.3e-17 PF02852: Pyr_redox_dim" amino acids 338 to 434 (97 residues), 43.9 bits, see alignment E=6.1e-15 PF00581: Rhodanese" amino acids 463 to 541 (79 residues), 23.4 bits, see alignment E=1.7e-08

Best Hits

KEGG orthology group: K05910, NADH peroxidase [EC: 1.11.1.1] (inferred from 100% identity to rru:Rru_A2309)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRY6 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Rru_A2309 NADH peroxidase (NCBI) (Rhodospirillum rubrum S1H)
MEQMSILVIGGVAAGASFAARARRLSETARITVLERGPDVSFANCGLPYHIGGEIPDRGA
LAVQSAASLKGLLNLDVRVQTEAVAIDPKGKRVEVRDLASGQSAWLPYDKLMLAPGASPL
RPPLPGIDDPRIFTLRNLQDMDRIIAATAPGQRAVVIGAGFIGLEMAEQLHRKGLGVDLV
ELQSQVLPPLDPPMAALVESELRRHDIGLHLGDAIARFESLGARLRCHLASDKTLDADIV
ILSIGVKPESDLARAAGLELGAKGHIVVDSFQRTSDPDIYAAGDGVETVDRILGGKTAVP
MGGPANRQGRVAADHIFLADKARPYPGSVGTGIVRAFDAVVGITGWSEKRLAAAGHPYET
VTVNDSHHASYYPGAKPMTLKILWEPDSGRLLGAQVSGSEGVDKRLDILSTAIIAGMTVE
DLCHLELAYAPPFGSAKDLVNLAGFAACNRRDGLVSHTTELPTDPQVQVIDVRGKPLAEA
YPAPGTTINIPFPTLRAHLDTLDKTRPVVTLCAFGKMSYFAARVLSQHGFTVKSFSGGLK
ANVDPRTPGKLPGA