Protein Info for Rru_A2308 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, ArsR family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF01022: HTH_5" amino acids 30 to 74 (45 residues), 44.8 bits, see alignment E=1.8e-15 PF01638: HxlR" amino acids 31 to 76 (46 residues), 22.3 bits, see alignment E=2e-08 PF12840: HTH_20" amino acids 37 to 75 (39 residues), 27.9 bits, see alignment E=3.9e-10

Best Hits

Swiss-Prot: 45% identical to BIGR_AGRFC: Biofilm growth-associated repressor (bigR) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 100% identity to rru:Rru_A2308)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRY7 at UniProt or InterPro

Protein Sequence (110 amino acids)

>Rru_A2308 Transcriptional Regulator, ArsR family (NCBI) (Rhodospirillum rubrum S1H)
MVAENSTLSVDAMRTAAAEATATLFALANQNRLLLLCQLCNGEMSVSALEEALGIHQPTL
SQQLGVLRSEGLIASRREGKRIYYSVANPKVLVLINTLVDLYCPQKRDLP