Protein Info for Rru_A2296 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF165 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 58 to 75 (18 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details PF02592: Vut_1" amino acids 31 to 73 (43 residues), 30.2 bits, see alignment 2.7e-11 amino acids 72 to 159 (88 residues), 62.7 bits, see alignment E=2.7e-21 TIGR00697: conserved hypothetical integral membrane protein" amino acids 72 to 163 (92 residues), 64.3 bits, see alignment E=6.5e-22

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 100% identity to rru:Rru_A2296)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RRZ9 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Rru_A2296 Protein of unknown function DUF165 (NCBI) (Rhodospirillum rubrum S1H)
MRTLVLPIAAMAVVVVSSNYLVQFPLNDWLTWGAFTYPVAFLVTEITNRLLGPVRARQVV
YVGFALAVGLSLFLADPRIAAASGSAFLVGQLLDVFVFNRLRRRVWWLPPLVSSTLGSML
DTAIFFSMAFAATGLPWITWAIGDLSVKLTMGLLLVAPFRIAIAYAFTRGALRDRDVMGA
R