Protein Info for Rru_A2284 in Rhodospirillum rubrum S1H

Annotation: Dinitrogenase iron-molybdenum cofactor biosynthesis (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR02663: nitrogen fixation protein NifX" amino acids 16 to 139 (124 residues), 161.6 bits, see alignment E=4.7e-52 PF02579: Nitro_FeMo-Co" amino acids 26 to 124 (99 residues), 58.9 bits, see alignment E=2.5e-20

Best Hits

Swiss-Prot: 54% identical to NIFX_SINFN: Protein NifX (nifX) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02596, nitrogen fixation protein NifX (inferred from 100% identity to rru:Rru_A2284)

Predicted SEED Role

"Nitrogenase FeMo-cofactor carrier protein NifX" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS11 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Rru_A2284 Dinitrogenase iron-molybdenum cofactor biosynthesis (NCBI) (Rhodospirillum rubrum S1H)
MVEAGPDRGSVTGGRMKVALATQDMKTVNAHFNGARHMAIYEVGPDGYSFVEVIQFDAVS
DEDGKHSDDGEDRVRAKVKALDGIALLFVKAIGGPAAARVVQSRIHPMKIPNDEPIVDVL
DRVQTMLKGNPPPWLRKIMTRDGAGENRLDFLDDEDMAEESL