Protein Info for Rru_A2282 in Rhodospirillum rubrum S1H

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 TIGR02936: ferredoxin III, nif-specific" amino acids 5 to 95 (91 residues), 139.5 bits, see alignment E=1.5e-45 PF12837: Fer4_6" amino acids 21 to 41 (21 residues), 29.3 bits, see alignment 2.3e-10 PF13237: Fer4_10" amino acids 22 to 86 (65 residues), 26.3 bits, see alignment E=2.3e-09 PF00037: Fer4" amino acids 22 to 42 (21 residues), 28 bits, see alignment 5.5e-10 PF12838: Fer4_7" amino acids 27 to 90 (64 residues), 34 bits, see alignment E=1.4e-11 PF13484: Fer4_16" amino acids 27 to 87 (61 residues), 32.7 bits, see alignment E=4.3e-11

Best Hits

Swiss-Prot: 52% identical to FER3_SINFN: Putative ferredoxin-3 (fdxB) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2282)

Predicted SEED Role

"4Fe-4S ferredoxin, nitrogenase-associated" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS13 at UniProt or InterPro

Protein Sequence (101 amino acids)

>Rru_A2282 4Fe-4S ferredoxin, iron-sulfur binding (NCBI) (Rhodospirillum rubrum S1H)
MGPLTFTTRDGSPWVPQYITAIDEALCIGCGRCFKVCGHDVLEMKGINDEGALCDPYDED
EEIVRKVMVVSHGGKCIGCEACGTVCGTKAQTHAPAEPALA