Protein Info for Rru_A2272 in Rhodospirillum rubrum S1H

Annotation: TspO and MBR related proteins (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details PF03073: TspO_MBR" amino acids 34 to 174 (141 residues), 150.3 bits, see alignment E=1.6e-48

Best Hits

KEGG orthology group: K07185, tryptophan-rich sensory protein (inferred from 100% identity to rru:Rru_A2272)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS23 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Rru_A2272 TspO and MBR related proteins (NCBI) (Rhodospirillum rubrum S1H)
MMGQTSGGCPTVHQAPTKRKRTMDQNSAITLAVFIGICMLTALSGAFFRPGKWYQTIRKP
SWNPPDKVFGPVWGILYIMIAVAGWLVWMTAPFSETMILPMTIFGVQLVMNFLWSGLFFG
AKRIDLALLEVSFLWISVIELILAFLPIHPLAGYLLIPYALWVSFAAFLNLVIYRLNRKP
TPVAEPAV