Protein Info for Rru_A2271 in Rhodospirillum rubrum S1H

Annotation: HesB/YadR/YfhF (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF01521: Fe-S_biosyn" amino acids 2 to 103 (102 residues), 70 bits, see alignment E=1e-23 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 3 to 106 (104 residues), 115.8 bits, see alignment E=4.9e-38

Best Hits

Swiss-Prot: 48% identical to Y4VC_SINFN: Uncharacterized protein y4vC (NGR_a01210) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K13628, iron-sulfur cluster assembly protein (inferred from 100% identity to rru:Rru_A2271)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family in Nif operon" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS24 at UniProt or InterPro

Protein Sequence (110 amino acids)

>Rru_A2271 HesB/YadR/YfhF (NCBI) (Rhodospirillum rubrum S1H)
MMTWTESAAAAVRKVVGRSPEAATGLRLMVSTGGCAGVVYRMGLEARAQDDDAVIDLGEA
KVFVDPQSLPLLDGARVDFVDSGTASGFVFDNPNALNTCSCGKSFSAATC