Protein Info for Rru_A2267 in Rhodospirillum rubrum S1H

Annotation: Electron transfer flavoprotein beta-subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF01012: ETF" amino acids 23 to 211 (189 residues), 145.3 bits, see alignment E=9.2e-47

Best Hits

Swiss-Prot: 73% identical to FIXA_BRADU: Protein FixA (fixA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03521, electron transfer flavoprotein beta subunit (inferred from 100% identity to rru:Rru_A2267)

MetaCyc: 66% identical to quinone reductase (NADH,flavodoxin) complex electron transfer flavoprotein component alpha subunit (Azotobacter vinelandii)

Predicted SEED Role

"Electron transfer flavoprotein, beta subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS28 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Rru_A2267 Electron transfer flavoprotein beta-subunit (NCBI) (Rhodospirillum rubrum S1H)
MHIVVCIKQVPDSAQIRVHPVTNTIMRQGVPTIINPYDLFALEEALRLRDKMGGKVTVLT
MGPPMADESLRKALGLGADAAVLLTDRFFAGSDTLATSYALAAGIRKIGEEEPVDIVFTG
KQTIDGDTAQVGPGIAKRLGLNQLTYVAAIRSLDLENRSIVVERRAEGGVQVLSTGLPCL
ITMLEGTNTLRRGAMDDMFRASRATIATWSAQQAGVDDIALCGLRGSPTVVKKVFAPQPR
KEKAKMVETAGKSDAEIAQATLDTLFSANPKLETDLRKLAAAS