Protein Info for Rru_A2256 in Rhodospirillum rubrum S1H

Annotation: Cytochrome c, class II (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01322: Cytochrom_C_2" amino acids 28 to 145 (118 residues), 103.7 bits, see alignment E=6.7e-34

Best Hits

Swiss-Prot: 100% identical to CYCP_RHORT: Cytochrome c' (Rru_A2256) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2256)

Predicted SEED Role

"putative c'cytochrome"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P00144 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Rru_A2256 Cytochrome c, class II (NCBI) (Rhodospirillum rubrum S1H)
MKRMMIVAALAALTTTTVAQAADPAAYVEYRKSVLSATSNYMKAIGITLKEDLAVPNQTA
DHAKAIASIMETLPAAFPEGTAGIAKTEAKAAIWKDFEAFKVASKKSQDAALELASAAET
GDKAAIGAKLQALGGTCKACHKEFKAD