Protein Info for Rru_A2253 in Rhodospirillum rubrum S1H

Annotation: Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 118 (106 residues), 66.6 bits, see alignment E=1.1e-22 PF00528: BPD_transp_1" amino acids 32 to 224 (193 residues), 70.4 bits, see alignment E=8.6e-24

Best Hits

Swiss-Prot: 41% identical to NOCM_AGRFC: Nopaline transport system permease protein NocM (nocM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to rru:Rru_A2253)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS42 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Rru_A2253 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI) (Rhodospirillum rubrum S1H)
MNLDLVATFLPKLLFEGLPVTLKLVTLAVAIGVFIAIPTALLRVHPSPLVRAFPYAFIFF
FRGTPLLIQIALVYYGLSTLPWIRENEVLWPILREPFWCALIAFALNTGAYSAEILRGAI
QAIPRGEVEAARAYGMRGLLIVRRIILPRAFQIGLPAYGNEIILILKGSALASSITLLDI
TGVARLLYARYYTPVEAFVTAGVIYLILVYLLTRGLRLIERRLSRHLLGPPETELAEDR