Protein Info for Rru_A2225 in Rhodospirillum rubrum S1H

Annotation: Two component Transcriptional regulator, Winged helix family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00072: Response_reg" amino acids 21 to 129 (109 residues), 107 bits, see alignment E=6.1e-35 PF00486: Trans_reg_C" amino acids 171 to 243 (73 residues), 64.9 bits, see alignment E=5.7e-22

Best Hits

Swiss-Prot: 54% identical to PETR_RHOCB: Protein PetR (petR) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K07659, two-component system, OmpR family, phosphate regulon response regulator OmpR (inferred from 100% identity to rru:Rru_A2225)

Predicted SEED Role

"DNA-binding response regulator PetR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS70 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Rru_A2225 Two component Transcriptional regulator, Winged helix family (NCBI) (Rhodospirillum rubrum S1H)
MSDPALPVAPVAPVTEEPPHILVVDDDTRILALLKRFLSERGFIVTAAADAAEARRQLAA
LRFDLLVVDVMMPGESGLELTRSIREDSDVPILILTAMDQPDDRVSGLESGADDYLAKPF
DPRELVLRVNGILRRLRQAPDLPPAAPPEGPLPLGACVFDPHRQELLRGDEVVRLTTAET
ALLSTLAARAGEAISREDLAELTGVAGNPRAIDVQVTRLRKKIEADPRVPRHLQTVRGRG
YMLRPG