Protein Info for Rru_A2224 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, MarR family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF12802: MarR_2" amino acids 44 to 102 (59 residues), 45.8 bits, see alignment E=8.1e-16 PF13463: HTH_27" amino acids 48 to 111 (64 residues), 22.6 bits, see alignment E=1.6e-08 PF01047: MarR" amino acids 49 to 102 (54 residues), 25 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 52% identical to PETP_RHOCB: HTH-type transcriptional regulator PetP (petP) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2224)

Predicted SEED Role

"HTH-type transcriptional regulator PetP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS71 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Rru_A2224 Transcriptional Regulator, MarR family (NCBI) (Rhodospirillum rubrum S1H)
MSEVKSGVNPLFLREEELRQGIELLFFAYRDFTSEADAMLAKHNFGRAHHRVIYFVGREP
KIGVSALLGILGITKQSLSRVLSQLVEEGLIVQHRGPRDGRQRLLELTEKGIDMERRLTE
AQRRRFARAYREAGAEAVEGFRKVMLGMIDGPARERFAAAAKRETPPSPPRVSRAGARR