Protein Info for Rru_A2221 in Rhodospirillum rubrum S1H

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 157 to 174 (18 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 3 to 167 (165 residues), 138.4 bits, see alignment E=1.3e-44 TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 3 to 175 (173 residues), 147.4 bits, see alignment E=3.3e-47

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 100% identity to rru:Rru_A2221)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS74 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Rru_A2221 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MLTLPNILTLLRILIIPLVVVLFYVDGEGYRWANCALFAVAAITDFFDGWLARRSNQVSR
LGRFLDPIADKLLVAAVLMLLVGFGRMSPWSYPAAVVILMREILVSGLREFLAEIRVGMP
VTKLAKWKTTVQLIALPVLIVGDTPLIPLPITLIGEGLLWVAAVMTIITGYDYLRVGLRH
MGPEHDAPPSQAHNTPR