Protein Info for Rru_A2220 in Rhodospirillum rubrum S1H

Annotation: Excinuclease ABC, C subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 TIGR00194: excinuclease ABC subunit C" amino acids 36 to 614 (579 residues), 531.5 bits, see alignment E=1.5e-163 PF01541: GIY-YIG" amino acids 44 to 119 (76 residues), 31.5 bits, see alignment E=5.5e-11 PF27096: UvrC_M" amino acids 128 to 224 (97 residues), 89.8 bits, see alignment E=4.1e-29 PF02151: UVR" amino acids 232 to 262 (31 residues), 30.4 bits, see alignment (E = 7.3e-11) PF22920: UvrC_RNaseH" amino acids 278 to 392 (115 residues), 128.8 bits, see alignment E=3e-41 PF08459: UvrC_RNaseH_dom" amino acids 409 to 569 (161 residues), 179.3 bits, see alignment E=1.5e-56 PF14520: HHH_5" amino acids 584 to 634 (51 residues), 34.2 bits, see alignment 8.9e-12

Best Hits

Swiss-Prot: 100% identical to UVRC_RHORT: UvrABC system protein C (uvrC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to rru:Rru_A2220)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS75 at UniProt or InterPro

Protein Sequence (639 amino acids)

>Rru_A2220 Excinuclease ABC, C subunit (NCBI) (Rhodospirillum rubrum S1H)
MTDLPVDEPDRDDGADQPDAGADPATPRGVEAIRAALRTMPSSPGVYRMIDGKGDVLYVG
KARNLKRRVINYTQPHRLPVRIQRMIAATLTMEVLTTHTEAEALLLESNLIKKLKPRYNI
LLRDDKSFPYIEITSDHAFPRIVKFRGTLRKGGEYFGPFASAGAVTSTLTALQKTFLLRT
CADNVFASRSRPCLLFQIKRCAAPCVDRVAEADYKALVEEARAFLSGSSKALQHDLAKRM
DEAAQALDYEQAAIFRDRIKALTNVQSHQDINLPTLGEADVIACHQAGGQTCVQVFFFRG
GRNNGNRSFFPAHAGDEGLPEVLEAFLGQFYAGFPPPREILLLTDIPHHDLVEQALCLRA
GHRVRLVVPRRGSRRKLIDHALANAREALGRRLAESSAQRTLLEGTAVAFGLDGPLQRVE
IYDNSHISGTHAVGGMVVAGPEGFMKAAYRKFNIRSPDITPGDDYAMMREVMIRRFARAR
KEDPDRDRGQWPDLVLIDGGLGQLNAVREALAEIGVEDVPLVGVAKGPDRDAGRERFFVP
GRPPFMLRHNDPVLYFIQRLRDEAHRFAIGSHRTRRSKAIGVSPLDSVPGIGASRKKALL
HHFGSAKAVSQAGLTDLEAVEGISAALAKKLYDHFHSEG