Protein Info for Rru_A2215 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, LysR family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 92 to 110 (19 residues), see Phobius details PF00126: HTH_1" amino acids 8 to 67 (60 residues), 79.5 bits, see alignment E=1.4e-26 PF03466: LysR_substrate" amino acids 91 to 297 (207 residues), 124.1 bits, see alignment E=5.3e-40

Best Hits

KEGG orthology group: K03566, LysR family transcriptional regulator, glycine cleavage system transcriptional activator (inferred from 100% identity to rru:Rru_A2215)

Predicted SEED Role

"Glycine cleavage system transcriptional activator GcvA" in subsystem Glycine cleavage system or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS80 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Rru_A2215 Transcriptional Regulator, LysR family (NCBI) (Rhodospirillum rubrum S1H)
MVRRLPPLNALRAFEAAARHGGFTGAARELHVTPAAVSHQVKGLEDALGVSLFHRLAKGL
ELTAAGRAYLPELTAGFDQLARASERLKRGALVGRLTVSVLPSFAAGWLAPRLASFLRRY
PDILLDLRSTPRTVDFIRERVDLGIRYGGGIYPGLASYRILEEEVFPICAPALLNGPVPL
RGFADLRHHVLLHDPGILPGEPWTGWEPWLAEAGVTDIDLEAGHGFTESIAMIHACVAGL
GVGIGRSGLVTELLRSGRLVRPFPVSRPADFSYWVVVPPPSQTNPKAAAFIGWLLETAGR
GGAGAGAQPDLLGEDPS